PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS525917.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MIKC_MADS
Protein Properties Length: 139aa    MW: 16143.7 Da    PI: 10.1056
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS525917.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.83.3e-29959151
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  k ien++nrqvt+skRrng++KKA+EL vLCda+v++i++sstgkl+ey+s
  EcS525917.10  9 KLIENTTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMISSTGKLHEYIS 59
                  569**********************************************86 PP

2K-box64.83.2e-2271139169
         K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskK 69 
                   yq++  ++l+++++e++q++l+kLk+ +++Lq e R++ Ge+L+ +sl eL  Leq+++++++ iR++K
  EcS525917.10  71 YQQALEVDLWSSHYEKMQENLRKLKEVNKKLQLEVRRRFGEGLNGMSLSELCGLEQDMDNAVSLIRERK 139
                   67788889************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.6E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.118161IPR002100Transcription factor, MADS-box
CDDcd002652.81E-37280No hitNo description
SuperFamilySSF554557.85E-37395IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-27323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.1E-241157IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-273859IPR002100Transcription factor, MADS-box
PfamPF014865.3E-1382139IPR002487Transcription factor, K-box
PROSITE profilePS5129711.23584139IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MARGKIQIKL IENTTNRQVT YSKRRNGLFK KANELTVLCD AKVSIIMISS TGKLHEYISP  60
STSTKKMYDQ YQQALEVDLW SSHYEKMQEN LRKLKEVNKK LQLEVRRRFG EGLNGMSLSE  120
LCGLEQDMDN AVSLIRERK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010061014.15e-98PREDICTED: floral homeotic protein DEFICIENS
SwissprotP237062e-71DEFA_ANTMA; Floral homeotic protein DEFICIENS
TrEMBLA0A059BPV35e-98A0A059BPV3_EUCGR; Uncharacterized protein
STRINGGLYMA06G02990.14e-70(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.16e-61MIKC_MADS family protein